PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000172476
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 406aa    MW: 44228.9 Da    PI: 8.9961
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000172476genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-15120165147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v q+G+ +W+ Ia+++  gR++k+c++rw++ 
    MDP0000172476 120 RGHWRPAEDSKLKELVGQYGPQNWNIIAEKLD-GRSGKSCRLRWFNQ 165
                      899*****************************.***********996 PP

2Myb_DNA-binding53.84.6e-17173215246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++++eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
    MDP0000172476 173 RAFSEEEEERLLVAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 215
                      689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.477115166IPR017930Myb domain
SMARTSM007175.4E-13119168IPR001005SANT/Myb domain
SuperFamilySSF466892.92E-27119213IPR009057Homeodomain-like
PfamPF002492.1E-14120165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-25121173IPR009057Homeodomain-like
CDDcd001674.68E-12123164No hitNo description
PROSITE profilePS5129426.093167221IPR017930Myb domain
SMARTSM007172.1E-14171219IPR001005SANT/Myb domain
PfamPF002495.5E-14173214IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-20174220IPR009057Homeodomain-like
CDDcd001671.20E-11174214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MGFQHLKSDC NGFTRYQDLN FSPPPPVSNQ LSLSNTFGGS STSAMGLGPF SPLSSQQTNK  60
PWSSQALENG GPKNISDHGV LFGVDLKRPV PLNLNLVGEE DDDEDRSPAG GRISAKSCAR  120
GHWRPAEDSK LKELVGQYGP QNWNIIAEKL DGRSGKSCRL RWFNQLDPRI NKRAFSEEEE  180
ERLLVAHRLY GNKWAMIARL FPGRTDNAVK NHWHVIMARK HREQSNVFKR RKPSSPPPPS  240
PPSPPPHVVA NFPKNPSTST ESTISISTIN DDSTQSASTC TDLSLTPSNK PPPTXFTKFH  300
PFHHHQNFGS HLGSSSSDGG FKKMIGSNGN GFCRSTGPVR GVGAAAAAMM GVDNSGHQSD  360
SNSDISGDES VTTTRTNLSL SGENQNLHHE KITSIHFIDF LGVGTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-331202204104C-Myb DNA-Binding Domain
1mse_C5e-331202204104C-Myb DNA-Binding Domain
1gv2_A7e-331202204104MYB PROTO-ONCOGENE PROTEIN
1a5j_A8e-331202207107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.170240.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351437.10.0PREDICTED: myb-like protein Q
TrEMBLM5VQV01e-169M5VQV0_PRUPE; Uncharacterized protein
STRINGPOPTR_0013s06320.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-71myb domain protein 105